Recombinant fragment corresponding to Human Oct4 aa 81-164.Sequence: WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYG SPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Conjugate
Unconjugated
Applications
Application Notes
Sandwich ELISA: 5 μg/ml; WB: 1 - 5 μg/ml.
Target
Alternative Names
POU5F1; POU class 5 homeobox 1; OTF3, POU domain class 5, transcription factor 1; POU domain, class 5, transcription factor 1; MGC22487; OCT3; Oct4; octamer-binding protein 3; octamer-binding protein 4; POU domain transcription factor OCT4; octamer-bindi
Transcription factor that binds to the octamer motif (5-ATTTGCAT-3). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DCABH-9788 in a publication? Let us know and earn a reward for your research.
Ledda, S; Bogliolo, L; et al. Characterization, isolation and culture of primordial germ cells in domestic animals: recent progress and insights from the ovine species. THERIOGENOLOGY 74:534-543(2010).
Jones, TD; Ulbright, TM; et al. OCT4 staining in testicular tumors - A sensitive and specific marker for seminoma and embryonal carcinoma. AMERICAN JOURNAL OF SURGICAL PATHOLOGY 28:935-940(2004).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-POU5F1 monoclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.